PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_012766-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family NF-YB
Protein Properties Length: 155aa    MW: 17342.8 Da    PI: 4.4257
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_012766-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB74.51.6e-231193385
          NF-YB  3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkv 85
                   ++d  lP a + +i+k++lP + ++++da++++ ec +efi +++se+++ c +e+++ti+++ +l al  lGf+dy+e++ +
  NNU_012766-RA 11 KEDVSLPKATMFKIIKEMLPPDVRVARDAQDLLVECCVEFINLISSESNEVCSQEEKRTIAPEHVLKALEVLGFHDYIEEVYA 93
                   68999**************************************************************************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.8E-388138IPR009072Histone-fold
SuperFamilySSF471131.04E-3412140IPR009072Histone-fold
PfamPF008083.9E-211579IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 155 aa     Download sequence    Send to blast
MEPMDIVGKS KEDVSLPKAT MFKIIKEMLP PDVRVARDAQ DLLVECCVEF INLISSESNE  60
VCSQEEKRTI APEHVLKALE VLGFHDYIEE VYAAYEQHKL ETLDSPKGGK WGSGAMMTEE  120
EALAEQQRMF AEARARMNGG VAIPKQSEPD RGLES
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_B4e-351213412133Transcription Regulator NC2 beta chain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010265330.11e-112PREDICTED: protein Dr1 homolog
SwissprotP495922e-87NC2B_ARATH; Protein Dr1 homolog
TrEMBLW1P7C11e-102W1P7C1_AMBTC; Uncharacterized protein
STRINGVIT_17s0000g04350.t012e-95(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23090.42e-90nuclear factor Y, subunit B13